Market News

Stay updated with the latest market trends, earnings, and economic indicators.

Showing news for:TATACONSUM
Clear all filters
FSSAI issues 9 notices to Swiggy Instamart following customer complaints on contaminated food, milk
negative
ET Markets - Industry 4h ago

FSSAI issues 9 notices to Swiggy Instamart following customer complaints on contaminated food, milk

FSSAI has issued nine notices to Swiggy Instamart due to multiple consumer complaints. Allegations include supplying expired, spoiled, and contaminated food products to customers. Specific products like eggs and protein powder were found unfit for consumption. The regulator also noted issues with FSSAI license numbers and grievance redressal. Swiggy Instamart must submit a detailed report or face legal action.

CONSUMERGANESHCPGODREJCPJUBLCPLLIBASSAWALIYASWIGGYTATACONSUMChemicalsConsumer Services
Tata Consumer Share Price Live Updates: Tata Consumer Stock Update
positive
ET Markets - Stocks 1d ago

Tata Consumer Share Price Live Updates: Tata Consumer Stock Update

ARSSBLCONSUMERTATACONSUMTATATECHFast Moving Consumer GoodsFinancial Services
Godrej Consumer shares climb 2% as ICICI Securities upgrades the stock to a buy, raises target price
positive
LiveMint - Markets 2d ago

Godrej Consumer shares climb 2% as ICICI Securities upgrades the stock to a buy, raises target price

ICICI Securities upgraded Godrej Consumer Products to 'buy', raising the target price to ₹1,300. With expectations for double-digit growth and a recovery in key markets, investor interest surges. 

CASHIETFCONSUMERGANESHCPGODREJCPGODREJINDINVENTUREJUBLCPLLIBASTATACONSUMChemicalsDiversified
Tata Consumer Share Price Live Updates: Tata Consumer's Current Price
positive
ET Markets - Stocks 2d ago

Tata Consumer Share Price Live Updates: Tata Consumer's Current Price

CONSUMERCURRENTTATACONSUMTATATECHConstructionFast Moving Consumer Goods
Tata Motors charts $100 billion automotive ambition, commits Rs 40,000 crore to India business
positive
ET Markets - Industry 3d ago

Tata Motors charts $100 billion automotive ambition, commits Rs 40,000 crore to India business

Tata Motors aims for a USD 100 billion automotive business by FY31. The company plans substantial capital expenditure for domestic operations and JLR. Passenger vehicles will focus on aspirational products and market share growth. Jaguar Land Rover will contribute significantly to the projected sales figures. Digital technologies and AI are key investments for future operations.

3PLANDAKCAPITCPCAPFELFELDVRFMNLFOCUSMOCAPITALTATACAPTATACONSUMTATATECHTMCVTMPVTNIDETFAutomobile and Auto ComponentsCapital Goods
Tata Consumer Share Price Live Updates: Tata Consumer's Price Movement Today
positive
ET Markets - Stocks 3d ago

Tata Consumer Share Price Live Updates: Tata Consumer's Price Movement Today

CONSUMERTATACONSUMTATATECHFast Moving Consumer GoodsFinancial Services
Tata Group stock shines after strong business update, upbeat analyst commentary
positive
CNBC TV18 - Markets 4d ago

Tata Group stock shines after strong business update, upbeat analyst commentary

HSBC believes regulatory uncertainties are easing and continues to view Titan as its preferred pick in the consumer discretionary space. The brokerage has also marginally raised its earnings estimates.

CONSUMERTATACONSUMTATATECHTITANConsumer DurablesFast Moving Consumer Goods
Titan shares in focus on Q1 business update; consumer business grows 41% YoY
positive
ET Markets - Stocks 4d ago

Titan shares in focus on Q1 business update; consumer business grows 41% YoY

Titan Company reported a 41% year-on-year rise in consumer businesses for the June quarter, driven by robust jewellery demand, retail expansion and strong international growth. The Tata Group firm added 77 stores during the quarter, while its jewellery, watches, eyecare and emerging businesses all posted healthy growth.

ALLETECCONSUMERFOCUSHEALTHYMOGSECRETAILSDREAMSTATACONSUMTATATECHTITANV2RETAILConsumer DurablesConsumer Services
Stocks to Watch for July 7: Titan, Trent, Cochin Shipyard and more
positive
CNBC TV18 - Markets 4d ago

Stocks to Watch for July 7: Titan, Trent, Cochin Shipyard and more

From Titan reporting a 41% year-on-year growth in its consumer businesses for Q1 FY27 to Tata Motors Passenger Vehicles reporting higher production and domestic sales during the April-June 2026 quarter, here are some stocks to track ahead of Tuesday trading session.

BBETF0432COCHINSHIPCONSUMERMOGSECTATACONSUMTATATECHTITANTMCVTMPVTRENTAutomobile and Auto ComponentsCapital Goods
Tata Consumer Share Price Live Updates: Tata Consumer's Price Movement Signals Positive Trend
positive
ET Markets - Stocks 5d ago

Tata Consumer Share Price Live Updates: Tata Consumer's Price Movement Signals Positive Trend

CONSUMERTATACONSUMTATATECHFast Moving Consumer GoodsFinancial Services
NEWS
neutral
Business Standard - Markets 7d ago

Godrej Consumer Products expects high-teens revenue growth in Q1 FY27

Godrej Consumer Products said it expects to deliver high-teens revenue growth in the June quarter (Q1 FY27), ahead of its full-year guidance of double-digit revenue growth, backed by strong high-single-digit underlying volume growth (UVG).

CONSUMERGANESHCPGODREJCPGODREJINDJUBLCPLLIBASMOGSECTATACONSUMChemicalsDiversified
Godrej Consumer Q1 Update: Revenue expected to grow in high-teens; margins below guidance range
neutral
CNBC TV18 - Markets 7d ago

Godrej Consumer Q1 Update: Revenue expected to grow in high-teens; margins below guidance range

Shares of Godrej Consumer Products Limited ended at ₹1,074.00, down by ₹3.30, or 0.31%, on the BSE.

BSECONSUMERGANESHCPGODREJCPGODREJINDJUBLCPLLIBASTATACONSUMChemicalsDiversified
Next